Importing Any Genes

From a JSON or CSV Source

To import genes into the app, you need to have admin privileges. Follow these steps to import genes:

• Navigate to the Admin Panel in the app's sidebar.

• Select the "App Imports" tab from the menu.

• Click on the "Genes" option.

• Prepare a properly formatted JSON array file that contains the gene data you wish to import. You can use a text editor or a spreadsheet software to create the file.

• Upload the JSON file by clicking on the "Choose File" button and selecting the file from your computer.

• Click on the "Upload to Server" button to start the gene import process.

Once the import process is complete, you can view the imported genes in the app's gene section.

tip

Upload a JSON array to bulk upload genes to the app.

tip

CSV files can be converted to JSON arrays using any online converters such as https://csvjson.com/csv2json

JSON Format Example

[
  {
  "accessionNumber": "Rv0262c",
  "geneName": "aac",
  "function": "Confers resistance to aminoglycosides (gentamicin, tobramycin, dibekacin, netilmicin, and 6'-N-ethylnetilmicin).",
  "product": "Aminoglycoside 2'-N-acetyltransferase Aac (Aac(2')-IC)",
  "functionalCategory": "virulence, detoxification, adaptation",
  "geneExternalIds": [
    {
      "geneAccessionNumber": "Rv0262c",
      "externalIdRef": "UniProt",
      "externalId": "P9WQG9"
    }
  ],
  "genePublicData": {
    "type": "CDS",
    "proteomics": null,
    "mutant": null,
    "comments": "Rv0262c, (MTCY06A4.06c), len: 181 aa. Aac, aminoglycoside 2'-N-acetyltransferase (aac(2')-IC) (see citation below), highly similar to NP_302635.1|NC_002677 aminoglycoside 2'-N-acetyltransferase from Mycobacterium leprae (182 aa); Q49157|AAC2_MYCFO|AAC aminoglycoside 2'-N-acetyltransferase from Mycobacterium fortuitum (195 aa), Contains GNAT (Gcn5-related N-acetyltransferase) domain. See Vetting et al. 2005. FASTA scores: opt: 884, E(): 0, (69.1% identity in 181 aa overlap); and P94968|AAC2_MYCSM|AAC aminoglycoside 2'-N-acetyltransferase from Mycobacterium smegmatis (210 aa) (see also citation below). Also similar to Q52424|AAC2_PROST aminoglycoside 2'-N-acetyltransferase from Providencia stuartii (178 aa). Belongs to the AAC(2')-I family of acetyltransferases. Note that previously known as aac(2')-IC..",
    "start": "314309",
    "end": "314854",
    "orientation": "-",
    "geneLength": "546",
    "location": "314309",
    "geneSequence": "GTGCACACCCAGGTACACACGGCCCGCCTGGTCCACACCGCCGATCTTGACAGCGAGACCCGCCAGGACATCCGTCAGATGGTCACCGGCGCGTTTGCCGGTGACTTCACCGAGACCGACTGGGAGCACACGCTGGGTGGGATGCACGCCCTGATCTGGCATCACGGGGCGATCATCGCGCATGCCGCGGTGATCCAGCGGCGACTGATCTACCGCGGCAACGCGCTGCGCTGCGGGTACGTCGAAGGCGTTGCGGTGCGGGCGGACTGGCGGGGCCAACGCCTGGTGAGCGCGCTGTTGGACGCCGTCGAGCAGGTGATGCGCGGCGCTTACCAGCTCGGAGCGCTCAGTTCCTCGGCGCGGGCCCGCAGACTGTACGCCTCACGCGGCTGGCTGCCCTGGCACGGCCCGACATCGGTACTGGCACCAACCGGTCCAGTCCGTACACCCGATGACGACGGAACGGTGTTCGTCCTGCCCATCGACATCAGCCTGGACACCTCGGCGGAGCTGATGTGCGATTGGCGCGCGGGCGACGTCTGGTAA",
    "molecularMass": null,
    "isoelectricPoint": null,
    "proteinLength": "181 AA",
    "proteinSequence": "VHTQVHTARLVHTADLDSETRQDIRQMVTGAFAGDFTETDWEHTLGGMHALIWHHGAIIAHAAVIQRRLIYRGNALRCGYVEGVAVRADWRGQRLVSALLDAVEQVMRGAYQLGALSSSARARRLYASRGWLPWHGPTSVLAPTGPVRTPDDDGTVFVLPIDISLDTSAELMCDWRAGDVW",
    "pfam": "P9WQG9",
    "m_Leprae": "ML2551",
    "m_Marinum": "MMAR_0522",
    "m_Smegmatis": "MSMEG_0434",
    "cryo": null,
    "xRay": null,
    "model": null,
    "ligand": null
  },
  "geneEssentiality": [],
  "geneProteinProduction": [],
  "geneProteinActivityAssay": [],
  "geneCRISPRiStrain": [],
  "geneResistanceMutation": [],
  "geneVulnerability": [],
  "geneHypomorphs": [],
  "geneUnpublishedStructures": []
  }
]

note

A module to automate this process is under way!.